Protein Info for HMPREF1078_RS01655 in Parabacteroides merdae CL09T00C40

Annotation: cytochrome c peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF14376: Haem_bd" amino acids 35 to 146 (112 residues), 92.6 bits, see alignment E=4.3e-30 PF03150: CCP_MauG" amino acids 179 to 325 (147 residues), 166 bits, see alignment E=1.9e-52 PF00034: Cytochrom_C" amino acids 334 to 449 (116 residues), 25 bits, see alignment E=8e-09

Best Hits

Swiss-Prot: 51% identical to YHJA_ECOLI: Probable cytochrome c peroxidase (yhjA) from Escherichia coli (strain K12)

KEGG orthology group: K00428, cytochrome c peroxidase [EC: 1.11.1.5] (inferred from 76% identity to pdi:BDI_1048)

MetaCyc: 51% identical to cytochrome c peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.-; 1.11.1.-; 1.11.1.-

Predicted SEED Role

"Cytochrome c551 peroxidase (EC 1.11.1.5)" (EC 1.11.1.5)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>HMPREF1078_RS01655 cytochrome c peroxidase (Parabacteroides merdae CL09T00C40)
MLNTILCKRTALPLGLLSLALVLPSCGSSEYKKYADNQAKQVASILRENGCMQCHSATAA
TPFYGNLPLIGPTVKADMREGTRYLDLTAMLEALDNGKLVSEADLAKVEDAALSGSMPPA
KYSHMPMHWGTNLDSDEKAVLLSWAKDVRKKNYSTPTVAEEFANEPVQPLMASIPTDSAK
VALGFDLYHDTRLSGDNTISCATCHGLATAGVDRKQYSEGIDGQFGGVNAPTVYNSALNI
LQFWDGRAADLKEQAAGPPLNPVEMGSHSFDEISAKLAEDKELSKRFLEVYPEGFNQSTI
TDAIAEFEKTLLTPSRFDKYLMGDKTALTAEEVAGYELFKENKCATCHTGVNLGGQSFEY
MGIKDNYFDYRGTELTDGDNGRYSVTKNEQDRHRFKTPTLRNVMLTPPYMHDGSIATVED
AIRIMHQFQIGKNISDADTKSLVAFLNTLTGEYKGELLQ