Protein Info for HMPREF1078_RS01355 in Parabacteroides merdae CL09T00C40

Annotation: efflux transporter outer membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 9 to 451 (443 residues), 284.6 bits, see alignment E=7e-89 PF02321: OEP" amino acids 60 to 241 (182 residues), 69.9 bits, see alignment E=1.3e-23 amino acids 269 to 449 (181 residues), 95.1 bits, see alignment E=2.4e-31

Best Hits

KEGG orthology group: None (inferred from 77% identity to bth:BT_2942)

Predicted SEED Role

"Outer membrane protein oprM"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>HMPREF1078_RS01355 efflux transporter outer membrane subunit (Parabacteroides merdae CL09T00C40)
MKKIIVLTTATALLSSCGIYTKYQPAETTPDNLYGEEVAVDDTTNFGNVNWRELFTDPQL
QALIEQGLQNNTDLRSAQLQIEEAEAALMSAKLAFLPSFALSPQGTISSFDGGKATKTYT
LPVTASWELDIFGRLRNAKQQAKALYAQSKDYQQAVRTQLIAGIANVYYTLLMLDEQLAI
SQQTEEAWKETVASTRALMDAGLANEAATSQMEAAYYSVQTSILDLKEQINQVENSLALL
LAETPRRYERGKLADQRLPEDVAVGVPMQMLSNRPDVRAAERSLEQAFYATNQARAAFYP
SIVLSGSAGWTNSAGSMIVNPGKFLASAVGSLTQPLFNKGQIMAQYRIAKAQQEEASLSF
QQALLNAGSEVNDALVACQTSKAKTLLFEKQIQSLEKALESTSLLMEHGTTTYLEVLTAR
QSLLSAQLSQTANRFTEIQSVINLYQALGGGRE