Protein Info for HMPREF1078_RS01310 in Parabacteroides merdae CL09T00C40

Annotation: lactate utilization protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02589: LUD_dom
  • amino acids 65 to 280 (216 residues), 143.7 bits, E=1.7e-45
• PF13183: Fer4_8
  • amino acids 301 to 366 (66 residues), 46.8 bits, E=1e-15
• PF13534: Fer4_17
  • amino acids 302 to 367 (66 residues), 32.3 bits, E=3.6e-11
• PF11870: LutB_C
  • amino acids 384 to 452 (69 residues), 28.3 bits, E=5.6e-10

Best Hits

KEGG orthology group: None (inferred from 84% identity to pdi:BDI_0583)

MetaCyc: 53% identical to L-lactate dehydrogenase iron-sulfur cluster-binding protein LldF (Shewanella oneidensis)
L-lactate dehydrogenase (cytochrome). [EC: 1.1.2.3]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

• methylglyoxal degradation V (3/3 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.3

Protein Sequence (455 amino acids)

>HMPREF1078_RS01310 lactate utilization protein B (Parabacteroides merdae CL09T00C40)
MSTKHSKAAARFIGNRKQEAWHDETLWMVRVKRDKMSHSLPEWERLRELACEIKLYSNSH
LDVLLEEFEKNATANGAIVHWAKDAAEHNAIVEEILQQHKAHTLIKSKSMLTEECGMNDY
LFGKGYDIIESDLGERILQWMKLHPSHIVMPAIHIKRQEVGEMMERVLGTEKGNSDPTYL
THAVRKNMREKFLTADVAMTGANFAVASTGEIVVCTNEGNADMGTSFPNVHIATFGMEKI
VPDRDSLGVFTRLLARSGTGQPITSYTSHYCKPKEGGEFHIIIVDNGRSDILACPDHIRT
LNCIRCGECMNTCPVYRRSGGYSYTYFIPGPIGINLGMLKDPVKYSDNVSACSLCLSCSN
VCPVKIDLGEQIYRWRQDLDKIGKASTEKKIMSGGMKFLMERPKLFNTALKFAPVVNNMP
RFMIYNALNAWGKGRELPAFAKQSFNEMWKSNKIK