Protein Info for HMPREF1078_RS01230 in Parabacteroides merdae CL09T00C40

Annotation: diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00652: diaminopimelate epimerase
  • amino acids 5 to 273 (269 residues), 286.5 bits, E=1.1e-89
• PF01678: DAP_epimerase
  • amino acids 7 to 131 (125 residues), 88.2 bits, E=2.2e-29
  • amino acids 152 to 267 (116 residues), 111.6 bits, E=1.2e-36

Best Hits

Swiss-Prot: 76% identical to DAPF_PARD8: Diaminopimelate epimerase (dapF) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 76% identity to pdi:BDI_0322)

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

• L-lysine biosynthesis VI (7/7 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• aspartate superpathway (19/25 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• L-lysine biosynthesis I (6/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (12/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Protein Sequence (274 amino acids)

>HMPREF1078_RS01230 diaminopimelate epimerase (Parabacteroides merdae CL09T00C40)
MTEPIRFTKMHGAGNDYIYVNTMAFPVRNPEELAIRLSAPHTGIGSDGLVLIGSSKIADF
SMRIFNADGSEAMMCGNASRCIGKYVYDKRLTNKKNITLETLSGIKELQLTTRKLSGPHE
EVTEVTVDMGCPVIGETALEIEAGDYFYTGTVISMGNPHLVIFVEDITNINLPVIGPLLE
CHPLFPNRTNVEFVQALSTDEVRMKVWERGSGITQACGTGACATAVASAVRGKTGRKTKV
VMDGGPLTIHWDESSGHVYMTGGAVKVFEGELEI