Protein Info for HMPREF1078_RS01125 in Parabacteroides merdae CL09T00C40

Annotation: bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase type II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00793: DAHP_synth_1" amino acids 16 to 253 (238 residues), 137 bits, see alignment E=6.1e-44 PF01817: CM_2" amino acids 272 to 349 (78 residues), 84.9 bits, see alignment E=4e-28

Best Hits

KEGG orthology group: K04516, chorismate mutase [EC: 5.4.99.5] (inferred from 91% identity to pdi:BDI_1379)

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase I beta (EC 2.5.1.54) / Chorismate mutase I (EC 5.4.99.5)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Phenylalanine and Tyrosine Branches from Chorismate (EC 2.5.1.54, EC 5.4.99.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.54 or 5.4.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>HMPREF1078_RS01125 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase type II (Parabacteroides merdae CL09T00C40)
MEMELESIMLPGIDPQRPIVIAGPCSAETEEQVMETARGIADKGIKLFRAGIWKPRTKPG
GFEGIGAEGLQWLKRVKKETGMYVATEVATKDHVFEALKAGIDVLWIGARTTVNPFAVQE
IADALKGVDVPVLIKNPVNPDLELWIGAFQRLYGAGIRRLGAIHRGFSSYDKKMYRNLPL
WHIPIELRRRMPNLPIFCDPSHIGGKRELIAPLCQQAMDLSFDGLIIESHCNPDCAWSDA
SQQITPDVLDYVLNLLVIRDSNQTTENLAELRRQIDGIDEQLLELLAKRMRISREIGVYK
KEHNMPILQSPRYSEILEKRSNMGEQMDLSTDFVKEILKEIHEESVRQQMIIMNEQ