Protein Info for HMPREF1078_RS00960 in Parabacteroides merdae CL09T00C40

Annotation: V-type ATP synthase subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 31% identical to VATD_BORBU: V-type ATP synthase subunit D (atpD) from Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

KEGG orthology group: K02120, V-type H+-transporting ATPase subunit D [EC: 3.6.3.14] (inferred from 95% identity to pdi:BDI_0829)

Predicted SEED Role

"V-type ATP synthase subunit D (EC 3.6.3.14)" in subsystem V-Type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>HMPREF1078_RS00960 V-type ATP synthase subunit D (Parabacteroides merdae CL09T00C40)
MAIKFQYNKTSLQQLEKQLKMRERSLPTIKSKESALRIEVKRTKDEVTKLELQLEQEIQS
YENMMALWNEFNPELIAVRDVSLSTKKIAGVVVPVLDEIEFEIGRYSLFNAPAWFTDGIE
LLKKLARTGIEAEFSGMKLELLEHARKKTTQKVNLFEKVQIPGYKDAIRKVKRFMEDEES
LSKSSQKIMRANQEKRKAKEEKEEAEV