Protein Info for HMPREF1078_RS00895 in Parabacteroides merdae CL09T00C40

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 88 to 389 (302 residues), 158.1 bits, see alignment E=1.4e-50 PF16576: HlyD_D23" amino acids 91 to 307 (217 residues), 56.7 bits, see alignment E=3.3e-19 PF13533: Biotin_lipoyl_2" amino acids 208 to 240 (33 residues), 27.3 bits, see alignment (E = 3.6e-10) PF13437: HlyD_3" amino acids 210 to 307 (98 residues), 39.2 bits, see alignment E=1.5e-13

Best Hits

KEGG orthology group: None (inferred from 80% identity to pdi:BDI_1606)

Predicted SEED Role

"Cation efflux system protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>HMPREF1078_RS00895 efflux RND transporter periplasmic adaptor subunit (Parabacteroides merdae CL09T00C40)
MKKIYLVWVIFAYILAGCNGNTAAHGEHEHEAHEHEEGHDHDHEGHDHEHEGHDHEHEET
GEGHAGEISFKKALAEAVGLQTSKVEPGVFTDVIKTSGRVMAAQGEESTVVATVPGVVTF
GNLSFVDGTAVRKGQAILSLASSSLSDGNVAAKAKYAYENAKKEYERMETLIGDKIVSAK
DFEQARLNYENAKVAWEAVAGKQTANGVSVVSPINGYLKNLQVKEGDYVTVGQPLATISQ
NSRLVLRAEVSEKYYNYLPSIQSANFRTPYDNVTYKLSDLRGRLLSYGKASDTNSFYVPV
TFEFDNKGAIIPGSFVEIYLLTAPMQNVISVPVSALIEEQGVYSVFVRVHEEAYKKVPVT
LGADNGSEVQILSGLNAGDEVVTVGAYQIKLASASNAIPAHTHNH