Protein Info for HMPREF1078_RS00845 in Parabacteroides merdae CL09T00C40

Annotation: YigZ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF01205: UPF0029" amino acids 20 to 125 (106 residues), 124 bits, see alignment E=1.3e-40

Best Hits

KEGG orthology group: None (inferred from 92% identity to pdi:BDI_0926)

Predicted SEED Role

"FIG000605: protein co-occurring with transport systems (COG1739)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>HMPREF1078_RS00845 YigZ family protein (Parabacteroides merdae CL09T00C40)
MADDSYKTIKQIAEGYYTEKRSRFISYAIPVRTVEEVKEQLDKYRKQYYDARHVCWAYML
GPERLTFRANDDGEPSSTAGKPILGQINSNGLTDILIVVIRYFGGIELGTSGLIVAYRTA
AAEAIAAAEIEERTVDEDITIAFEYPYLNGIMRIVKEENPVIVSQKFEMDCEMTLRIRKG
EAERLKARLLKVESVYIPRTEF