Protein Info for HMPREF1078_RS00820 in Parabacteroides merdae CL09T00C40

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03990: phosphoglucosamine mutase
  • amino acids 4 to 457 (454 residues), 536.8 bits, E=2.1e-165
• PF02878: PGM_PMM_I
  • amino acids 8 to 142 (135 residues), 98.6 bits, E=5.2e-32
• PF02879: PGM_PMM_II
  • amino acids 172 to 264 (93 residues), 81.1 bits, E=1.6e-26
• PF02880: PGM_PMM_III
  • amino acids 271 to 376 (106 residues), 68.6 bits, E=1.1e-22
• PF00408: PGM_PMM_IV
  • amino acids 397 to 457 (61 residues), 37.8 bits, E=3.2e-13

Best Hits

Swiss-Prot: 36% identical to PGMMM_THEKO: Phosphoglucomutase/phosphomannomutase (TK1108) from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)

KEGG orthology group: K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 91% identity to pdi:BDI_1691)

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8) / Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis or Alginate metabolism or Mannose Metabolism (EC 5.4.2.10, EC 5.4.2.8)

MetaCyc Pathways

• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen degradation I (7/8 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• D-galactose degradation I (Leloir pathway) (4/5 steps found)
• GDP-mannose biosynthesis (3/4 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (3/4 steps found)
• starch degradation V (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• glycogen degradation II (4/6 steps found)
• UDP-α-D-glucose biosynthesis (1/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• sucrose biosynthesis II (5/8 steps found)
• starch degradation III (2/4 steps found)
• O-antigen building blocks biosynthesis (E. coli) (7/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (3/6 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (2/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)
• starch biosynthesis (5/10 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• peptidoglycan recycling I (7/14 steps found)
• chitin biosynthesis (3/9 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
• CMP-legionaminate biosynthesis I (1/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (7/19 steps found)
• streptomycin biosynthesis (2/18 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (5/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.8

Use Curated BLAST to search for 5.4.2.10 or 5.4.2.8

Protein Sequence (462 amino acids)

>HMPREF1078_RS00820 phosphoglucosamine mutase (Parabacteroides merdae CL09T00C40)
MTLIKSISGIRGTIGGNPEDGLNPLAIVKFVAAYATFIKKNTKVTTNKIVVGRDARISGP
MVKQVVLGALTGMGFDVVDIDLATTPTTELAVAWEEACGGIILTASHNPKQWNALKLLNE
RGEFLNAAEGAEVLKIAAEESFVFADVDNLGKVYVNNTYNQKHIESVLKLDLVDVEAIRA
ANFRVAIDCVNSVGGVVIPELLSALGVKEIFKLHCAPHGNFAHNPEPIPENLTEISDLMK
HAKADVGFVVDPDVDRLAIISEDGEMFGEEYTLVAVSDYVLSHTPGNTVSNLSSSRALRD
VTRAHGCEYNAAAVGEVNVVTKMKATNAIIGGEGNGGVIYPASHYGRDALVGIALFLTHL
AKKQMKTSELRASYPPYFISKKKVELTPDIDVDAILAKVKEKFAQYDITDIDGVKIDFPE
KWVHLRKSNTEPIIRIYSEAHTMQEAEEIGDELIQIIRDMCK