Protein Info for HMPREF1078_RS00805 in Parabacteroides merdae CL09T00C40

Annotation: ComEC/Rec2 family competence protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 311 to 335 (25 residues), see Phobius details amino acids 344 to 360 (17 residues), see Phobius details amino acids 375 to 394 (20 residues), see Phobius details amino acids 401 to 418 (18 residues), see Phobius details PF03772: Competence" amino acids 129 to 393 (265 residues), 189.8 bits, see alignment E=3.2e-60 TIGR00360: ComEC/Rec2-related protein" amino acids 149 to 326 (178 residues), 79.1 bits, see alignment E=2.4e-26

Best Hits

Predicted SEED Role

"Competence protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>HMPREF1078_RS00805 ComEC/Rec2 family competence protein (Parabacteroides merdae CL09T00C40)
MIKELQIRPFARPLLVWIAGAILQTVFSCCTYSWVLLLLPVIILTTAGLALRGQEHFCYE
TRWLWGAVFLSLLLFLSIQKTAYSQFEASSEHPTSLLSRWAREEQQRLLEPIEKLNLTDE
EKSVLATITVGYRQAMSREVRNRFSVTGVAHILAVSGFHVAIVCGFLSFLFSFLSRNGCC
RWIRYISLLVLLWGFVAITGLAASSVRAALMLTMYLTGGVLDRRAERYNILAASAFCMLV
YEPLYLFDIGFQLSYLAVLSILYFQPRLQALIKVHNPFLRTPWGWVTVTLSAQAGTTFLC
LYYFGQFSTVFLLTNLPLTFLATLLIPASLVYMFLPEWIPGYGWLQVGVEWLAHDLLWVV
DAFSQVPGAVFSFRFDFPAMLVAYGMLLSILLYGHTGRSRYLLVILFLLLIILLVRVIED
LKQCGI