Protein Info for HMPREF1078_RS00705 in Parabacteroides merdae CL09T00C40

Annotation: dTDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF04321: RmlD_sub_bind" amino acids 4 to 198 (195 residues), 33.2 bits, see alignment E=9.2e-12 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 4 to 363 (360 residues), 462.4 bits, see alignment E=3.5e-143 PF16363: GDP_Man_Dehyd" amino acids 5 to 348 (344 residues), 301 bits, see alignment E=4.2e-93 PF01370: Epimerase" amino acids 5 to 257 (253 residues), 227.9 bits, see alignment E=3.7e-71 PF02719: Polysacc_synt_2" amino acids 5 to 118 (114 residues), 42.5 bits, see alignment E=1.4e-14 PF01073: 3Beta_HSD" amino acids 5 to 240 (236 residues), 42.2 bits, see alignment E=1.5e-14 PF07993: NAD_binding_4" amino acids 6 to 194 (189 residues), 38.3 bits, see alignment E=2.7e-13

Best Hits

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 92% identity to pdi:BDI_1834)

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>HMPREF1078_RS00705 dTDP-glucose 4,6-dehydratase (Parabacteroides merdae CL09T00C40)
MKTYLITGAAGFIGANFIKYMLAKYPEIKIVVLDLLTYAGNLGTIAEDIDGERCEFVKGN
ICDRALTDELFAKYQFDYVVNFAAESHVDRSIENPQLFLVTNILGTQNLLDSARKAWVTG
KAATGYPEWREGVRFHQVSTDEVYGSLGAEGYFHETTPLDPRSPYSASKTSADLFVQAYS
ETYKMPVSITRCSNNYGPYHFPEKLIPLIIKNILEGKSLPVYGDGTNVRDWLYVEDHCKA
IDLVIHKGRAGEVYNVGGHNEKQNIEIVKLTISTIRRLMTEQPEYRRILKKKEIGADGQI
SIDWINDSLITFVKDRLGHDQRYAIDPTKITNELGWTPETSFETGIVKTIRWYLDNQKWV
EDITGGDYMKYYERMYGNR