Protein Info for HMPREF1078_RS00665 in Parabacteroides merdae CL09T00C40

Annotation: UDP-N-acetylmuramate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase
  • amino acids 9 to 337 (329 residues), 217.1 bits, E=1.6e-68
• PF01565: FAD_binding_4
  • amino acids 26 to 143 (118 residues), 47.6 bits, E=1.5e-16
• PF02873: MurB_C
  • amino acids 213 to 336 (124 residues), 91.1 bits, E=4.3e-30

Best Hits

Swiss-Prot: 50% identical to MURB_PORG3: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 79% identity to pdi:BDI_1148)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)
• peptidoglycan recycling I (7/14 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Protein Sequence (337 amino acids)

>HMPREF1078_RS00665 UDP-N-acetylmuramate dehydrogenase (Parabacteroides merdae CL09T00C40)
MRIEENYSLEKHNTFHLPVKARWFMEYTNEEELGRIFRDEYFQECLSLHIGSGSNLLFIN
DFNGVILHSQIKGISVAKETDDSVLLRIGAAEKWDDVVAYAVSKGWGGIENLSGIPGEVG
AAAVQNIGAYGTEIKDVVETVETYNQLSFEKRMFTNEECLYSYRDSFFKNEHNDPHIVTY
VNIRLSKKPRFSVNYGNLKEELAKYPKITLQAVRDAVISIRRQKLPDSDELGNAGSFFMN
PVIPVVHYEKLKRQYPDMPSYPAGEGKMKVPAGWLIEQCGFKGKSHGAVGVYEKQALVLV
NLGEAKGHEIALVAESIRTAVHDRFGIEIMPEVKYVG