Protein Info for HMPREF1078_RS00655 in Parabacteroides merdae CL09T00C40

Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14681: UPRTase
  • amino acids 11 to 214 (204 residues), 131 bits, E=4.3e-42
• PF00156: Pribosyltran
  • amino acids 72 to 176 (105 residues), 31.3 bits, E=1.2e-11

Best Hits

Swiss-Prot: 69% identical to UPP_PORG3: Uracil phosphoribosyltransferase (upp) from Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 85% identity to pdi:BDI_1151)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• pyrimidine nucleobases salvage I (1/1 steps found)
• superpathway of pyrimidine nucleobases salvage (3/4 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
• pyrimidine nucleobases salvage II (1/2 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.9

Protein Sequence (217 amino acids)

>HMPREF1078_RS00655 uracil phosphoribosyltransferase (Parabacteroides merdae CL09T00C40)
MKIVNLGESNSVLNRFVAELRDVNIQKDSMRFRRNIERIGEIMAYEISKDFTYSKKGIQS
PLGIAPMNTPDDSVVISTILRAGLPYHQGFLNYLDNAENAFVSAYRKYKDRLNFDIHIEY
IASPRLTDKTLIITDPMLATGSSMELAYEALRTKGHPAHIHVASIIASKQAIEYLQRKMP
DDITTIWVAAVDDELDDHSYIVPGLGDAGDLSYGEKE