Protein Info for HMPREF1078_RS00330 in Parabacteroides merdae CL09T00C40

Annotation: tRNA lysidine(34) synthetase TilS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 21 to 200 (180 residues), 172 bits, see alignment E=1.3e-54 PF01171: ATP_bind_3" amino acids 21 to 195 (175 residues), 162.1 bits, see alignment E=1.2e-51 PF11734: TilS_C" amino acids 362 to 429 (68 residues), 28.7 bits, see alignment E=6.8e-11 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 362 to 407 (46 residues), 35.1 bits, see alignment 7.1e-13

Best Hits

Swiss-Prot: 71% identical to TILS_PARD8: tRNA(Ile)-lysidine synthase (tilS) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 71% identity to pdi:BDI_1399)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>HMPREF1078_RS00330 tRNA lysidine(34) synthetase TilS (Parabacteroides merdae CL09T00C40)
MRDVVRAYIEKYRLLTENRPVLVGVSGGADSIALLTILVESGYSCIAAHCNFHLRGDESL
RDEQFVREYARKLDVPFLMTDFDTRKYAADRHLSIEMAARELRYGWFEEQRAATGAQAVA
VAHHRDDSVETLLMNLVRGTGIRGMSGIRPRNGFVVRPLLAVSREDILEWLAGRGLTYVT
DSTNLSDAYTRNFIRLRVLPLLEEINPSVKDAIARTSEHLSAAEAVYLHVVEEARNAVVE
QGDRLSIAALMRYPSPDAILYELLKTYGFTRPVAEDVYLSLTKESGKTFFSSTHRLIKDR
DYLLLSPLVKEEVREYTLTGGEKVWSGPVELSFEKIVIKEDFHIRKDKNIAYFDYDKLTF
PLTLRTWKEGDWFIPFGMKGRKKLSDYFSDHKFSRLDKERTWLLCSGGAVIWIVGERSDN
RFCLDKTTKSVLVVNFFPTKSESN