Protein Info for HMPREF1078_RS00135 in Parabacteroides merdae CL09T00C40

Annotation: anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF02885: Glycos_trans_3N" amino acids 2 to 62 (61 residues), 54.9 bits, see alignment E=6e-19 TIGR01245: anthranilate phosphoribosyltransferase" amino acids 7 to 327 (321 residues), 293.2 bits, see alignment E=1.4e-91 PF00591: Glycos_transf_3" amino acids 75 to 320 (246 residues), 209.3 bits, see alignment E=7.7e-66

Best Hits

Swiss-Prot: 81% identical to TRPD_BACFR: Anthranilate phosphoribosyltransferase (trpD) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 88% identity to pdi:BDI_0589)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>HMPREF1078_RS00135 anthranilate phosphoribosyltransferase (Parabacteroides merdae CL09T00C40)
MKDILYRLFEHQYLGRDEARTILQNIAEGKYNDSQIASLITVYLMRNISVEELAGFREAL
LEMRVPVDLSEFKPIDIVGTGGDGKNTFNISTASCFVVAGAGYNVVKHGNYGATSVSGAS
NVMEQHGVKFTADIDRLRRSMESCHIAYLHAPLFNPALKAVAPIRKSLGVRSFFNMLGPL
VNPVMPTYQLLGVYNLPLLRLYSYTYQESGTRFAVVHSLDGYDEISLTAEFKVAMPEKEK
LYTPEMLGFSRTTEAELDGGETVAEAARIFDDVLNNRATPAQKNCVIANSAFAIQVICPE
KRISECLEEAQEALESGKALQTFNTFISLNDKLQ