Protein Info for HMPREF1058_RS18790 in Phocaeicola vulgatus CL09T03C04

Annotation: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF02527: GidB" amino acids 16 to 192 (177 residues), 122.8 bits, see alignment E=1.7e-39 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 21 to 204 (184 residues), 119.6 bits, see alignment E=6.3e-39 PF05175: MTS" amino acids 62 to 134 (73 residues), 24.4 bits, see alignment E=3.1e-09 PF13847: Methyltransf_31" amino acids 63 to 167 (105 residues), 52.4 bits, see alignment E=7.7e-18

Best Hits

Swiss-Prot: 100% identical to RSMG_BACV8: Ribosomal RNA small subunit methyltransferase G (rsmG) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 100% identity to bvu:BVU_3021)

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9ULD7 at UniProt or InterPro

Protein Sequence (209 amino acids)

>HMPREF1058_RS18790 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (Phocaeicola vulgatus CL09T03C04)
MELILKYFPNLSEQQKTQFAALYDLYTDWNSKINVISRKDITNLYEHHVLHSLGIAKVIN
FTPDTQIMDLGTGGGFPGIPLAILFPEVQFHLVDSIGKKVKVATEIANAIGLKNVTFRHC
RAEEEKRKFDFVVSRAVMPLGDLIKIIRKNIRQEQHNALPNGLICLKGGELEQETMPVKH
KTMLYDLKNEFTEDFFKTKKVVYVTISGL