Protein Info for HMPREF1058_RS18690 in Phocaeicola vulgatus CL09T03C04

Annotation: F0F1 ATP synthase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 TIGR00962: ATP synthase F1, alpha subunit" amino acids 5 to 519 (515 residues), 747.4 bits, see alignment E=3.8e-229 PF02874: ATP-synt_ab_N" amino acids 29 to 93 (65 residues), 60.7 bits, see alignment E=2.4e-20 PF00006: ATP-synt_ab" amino acids 152 to 390 (239 residues), 260.4 bits, see alignment E=2e-81 PF00306: ATP-synt_ab_C" amino acids 397 to 520 (124 residues), 133.5 bits, see alignment E=8.3e-43

Best Hits

Swiss-Prot: 100% identical to ATPA_BACV8: ATP synthase subunit alpha (atpA) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K02111, F-type H+-transporting ATPase subunit alpha [EC: 3.6.3.14] (inferred from 100% identity to bvu:BVU_3000)

Predicted SEED Role

"ATP synthase alpha chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A7Z6 at UniProt or InterPro

Protein Sequence (530 amino acids)

>HMPREF1058_RS18690 F0F1 ATP synthase subunit alpha (Phocaeicola vulgatus CL09T03C04)
MSENIKPSEVSEVLLQQLKGIDTHLQFDEVGNVLQVSDGVARIYGLRNAEANELLEFENG
IMAIVMNLEEDNVGAVLLGPTDQIKEGMVVKRTKRIASINVGEGMLGRVIDPLGVPLDGR
GQIGGELCEMPLERKAPGVIFRQPVNQPLQTGLKSVDAMIPIGRGQRELIIGDRQTGKTS
IAIDTILNQKSNYEAGKPVYCIYVAIGQKGSTVASLVNTLRERGAMDYTIVVAATAADPA
ALQYFAPFAGAAIGEYFRDTGRDALVVYDDLSKQAVAYREVSLILRRPSGREAYPGDIFY
LHSRLLERAAKIINQQEVAEQMNDLPPSLKGKVKAGGSLTALPIIETQAGDVSAYIPTNV
ISITDGQIFLETDLFNQGFRPAINVGISVSRVGGSAQIKSMKKVAGTLKIDQAQYRELEA
FSKFSSDMDPVTAMAIDRGRKNNQLLIQPQYSPMPVGEQIAILYCGTHSLLRDVPLHKVQ
DFQKSFLEMMRADHQKDVLDVLSSGVINDDVTAIIEKVAADTAQPFKVNE