Protein Info for HMPREF1058_RS18550 in Phocaeicola vulgatus CL09T03C04

Annotation: YihA family ribosome biogenesis GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 TIGR03598: ribosome biogenesis GTP-binding protein YsxC" amino acids 6 to 191 (186 residues), 217.1 bits, see alignment E=8.3e-69 PF02421: FeoB_N" amino acids 26 to 163 (138 residues), 30.4 bits, see alignment E=4e-11 PF01926: MMR_HSR1" amino acids 26 to 143 (118 residues), 67.1 bits, see alignment E=2.2e-22

Best Hits

Swiss-Prot: 100% identical to ENGB_BACV8: Probable GTP-binding protein EngB (engB) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K03978, GTP-binding protein (inferred from 100% identity to bvu:BVU_2968)

Predicted SEED Role

"GTP-binding protein EngB" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A6X9 at UniProt or InterPro

Protein Sequence (200 amino acids)

>HMPREF1058_RS18550 YihA family ribosome biogenesis GTP-binding protein (Phocaeicola vulgatus CL09T03C04)
MEILSAEFVVSNTKVEKCPQDNLPEYAFIGRSNVGKSSLINMLAKRPKLAMTSSTPGKTL
LINHFLINKEWYLVDLPGYGYASRGKKQVEKIQQIIEDYILDREQMTNLFVLIDCRLEPQ
KIDLEFMEWLGENGVPFSIIFTKADKLTNGKVKDNVNKYLKKLTEQWEELPPHFVSSSEK
KTGRQEILDYIDSINRSLKA