Protein Info for HMPREF1058_RS18545 in Phocaeicola vulgatus CL09T03C04

Annotation: DEAD/DEAH box helicase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 770 PF04851: ResIII" amino acids 7 to 142 (136 residues), 85.7 bits, see alignment E=1.2e-27 PF00270: DEAD" amino acids 21 to 80 (60 residues), 28.9 bits, see alignment 3.1e-10 PF13604: AAA_30" amino acids 28 to 127 (100 residues), 27.2 bits, see alignment E=1.1e-09 PF09848: SLFN-g3_helicase" amino acids 30 to 119 (90 residues), 20.9 bits, see alignment E=6.9e-08 PF00271: Helicase_C" amino acids 223 to 322 (100 residues), 60.3 bits, see alignment E=7.4e-20

Best Hits

KEGG orthology group: None (inferred from 99% identity to bvu:BVU_2967)

Predicted SEED Role

"putative helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9ULI5 at UniProt or InterPro

Protein Sequence (770 amino acids)

>HMPREF1058_RS18545 DEAD/DEAH box helicase family protein (Phocaeicola vulgatus CL09T03C04)
MYCMNDTLRDYQQEMKLRLFKEWELHRSVMVQMPTGTGKTHLLAAIVREFLRGSGSRVWI
VAHRRELVDQIEETVSRHGMSKEDGRVRVMSIQWLSRNRKSMDEEPDLIVIDEAHHALAE
TYRILWENYPEARKLGMTATPCRLNGKGFTDLFNSLIASWTVAEFIGKGWLSSFDYVSIR
ANSREQRLIDSLKKRGADGDYQVKEMNEVLNRETSIGRLYESVERYARGKKGIVYAVSIA
HARRIAACYSAHGLEAVAIDSRTPASERRELVEDFRRGKVKVLVNVDIFSEGFDCPDVEF
VQLARPTLSLAKYLQQVGRGLRRSADKASCMLIDNVGLYRIFGLPARNHDWAAMFEGRMI
GNALSRARAETGRLSVSGLLPEEERQREDELEVVITHDRLMDFLTNREDSATEKGGQPVL
KSYYDRQSGLWGLRRGERMTVRPRYPEVFDICGDRAAVRFGNNRAGVVNETGQPGIQLDR
CRKMKFMKGDLLAVTDCAGNESYIDLKVNRTYREKPVVLSFGCMELPYGGVELLKVGAFF
FSRTGKPYVSMRGVDQNGIYFYDFYLKIPDYRVPKDCQLVDPVWTTLFDVFACVLAGDEE
EVYWCCGRLADRSIVVMDGNGNYYHVEKGKEKRYIACNTPRPGEEDFHTVMERLKEEAGR
RAGIAQRKQLQEEERKRLKRLEEIRDALPFRMGMKWGLKLGERIIVPPKYRKILPPVGYY
CAYEENACQWGIMALDGKVVVEARYQKVDIECNGTVHLTVIPGKVKTIKL