Protein Info for HMPREF1058_RS18480 in Phocaeicola vulgatus CL09T03C04

Annotation: NAD-dependent epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 276 (276 residues), 57.1 bits, E=4.1e-19
• PF01370: Epimerase
  • amino acids 3 to 270 (268 residues), 186 bits, E=1.9e-58
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 331 (328 residues), 168.9 bits, E=5.2e-53
• PF01073: 3Beta_HSD
  • amino acids 4 to 298 (295 residues), 51.5 bits, E=1.9e-17
• PF02719: Polysacc_synt_2
  • amino acids 78 to 289 (212 residues), 36.7 bits, E=7.2e-13

Best Hits

KEGG orthology group: K01795, [EC: 5.1.3.-] (inferred from 60% identity to nsa:Nitsa_1999)

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• O-antigen building blocks biosynthesis (E. coli) (9/11 steps found)
• dTDP-4-O-demethyl-β-L-noviose biosynthesis (3/5 steps found)
• dTDP-β-D-fucofuranose biosynthesis (2/4 steps found)
• dTDP-6-deoxy-α-D-allose biosynthesis (2/4 steps found)
• dTDP-N-acetylthomosamine biosynthesis (2/4 steps found)
• dTDP-N-acetylviosamine biosynthesis (2/4 steps found)
• dTDP-L-daunosamine biosynthesis (3/6 steps found)
• dTDP-sibirosamine biosynthesis (3/6 steps found)
• dTDP-α-D-mycaminose biosynthesis (2/5 steps found)
• dTDP-3-acetamido-α-D-fucose biosynthesis (2/5 steps found)
• dTDP-3-acetamido-3,6-dideoxy-α-D-glucose biosynthesis (2/5 steps found)
• dTDP-β-L-digitoxose biosynthesis (3/7 steps found)
• dTDP-β-L-olivose biosynthesis (3/7 steps found)
• dTDP-α-D-ravidosamine and dTDP-4-acetyl-α-D-ravidosamine biosynthesis (2/6 steps found)
• dTDP-D-desosamine biosynthesis (2/6 steps found)
• dTDP-β-L-4-epi-vancosamine biosynthesis (3/8 steps found)
• dTDP-β-L-megosamine biosynthesis (3/8 steps found)
• dTDP-β-L-mycarose biosynthesis (2/7 steps found)
• dTDP-α-D-forosamine biosynthesis (3/9 steps found)
• dTDP-α-D-olivose, dTDP-α-D-oliose and dTDP-α-D-mycarose biosynthesis (3/9 steps found)
• superpathway of enterobacterial common antigen biosynthesis (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of novobiocin biosynthesis (4/19 steps found)
• superpathway of erythromycin biosynthesis (2/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (11/33 steps found)
• superpathway of megalomicin A biosynthesis (3/22 steps found)
• superpathway of dTDP-glucose-derived antibiotic building blocks biosynthesis (3/23 steps found)

KEGG Metabolic Maps

• Biosynthesis of vancomycin group antibiotics
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46, 5.1.3.-

Use Curated BLAST to search for 4.2.1.46 or 5.1.3.-

Sequence Analysis Tools

See I9A844 at UniProt or InterPro

Protein Sequence (345 amino acids)

>HMPREF1058_RS18480 NAD-dependent epimerase (Phocaeicola vulgatus CL09T03C04)
MKILVTGAAGFIGSKLSYALACRGDEVVGLDCINDYYDVRLKYGRLQECGLPVSEADCDY
GATFQSTLFPNYKFIRLGIEDKQELFRLFEQEKFDKVMNLAAQAGVRYSISNPYAYMESN
LHGFLNILEACRYYGVKHLIFASSSSVYGMNTKVPFSEDDKVDTPVSLYAASKKSNELMA
HAYSKLYGFAVSGLRYFTVYGPWGRPDMAPMLFAKAISAGEPIKVFNNGLLSRDFTYIDD
IVEGTVRVIDHLPASEDVLDGVAYKIYNIGCGHPMQLMDFIHELEQALGRESRKVYLPMQ
QGDVYQTYADTSRLEQEVGYKPRVSLHEGIGQFIEWYKSEKNPLK