Protein Info for HMPREF1058_RS18440 in Phocaeicola vulgatus CL09T03C04

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 47 to 73 (27 residues), see Phobius details amino acids 86 to 112 (27 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details amino acids 407 to 425 (19 residues), see Phobius details amino acids 445 to 463 (19 residues), see Phobius details amino acids 469 to 490 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 53% identity to bfs:BF2791)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A854 at UniProt or InterPro

Protein Sequence (510 amino acids)

>HMPREF1058_RS18440 hypothetical protein (Phocaeicola vulgatus CL09T03C04)
MISNFSNNKRIAKNTLILYVRMLFMMLVALYTSRVILNVLGVEDFGIYNVVGGLVSMFAL
VSGAISISISRFITFELGRNNQKELNIVFSSAIIIQIVICLLFILLAETLGLWFLNTKMS
FPEGRMCATNVIFQFSVATFCVNLISIPYNAAIIAHEKMAAFAYISIFETLAKLIIAFAI
PYILYDKLIIYGGLLLLVAIIVRLVYGIYCKYHFEECRFRFLFDKTVFYNMFTYAGWTYI
GASSALLRDTGGNILINLFYGPVANAANGIGTQVQQAVNQFVTNFMTALNPQIIKSYAAA
NYDYMKFLVLNASRISYYMMLFFSLPILFNTHYILVLWLEQVPQYCVEFVRLALLFVMSE
SLSTPLITSASASGKIKKYQLLVGGIQSFNFPLSLLCLYMGMPPYVTFVVAICISQLCLA
GRLYILRNMMDFSARQFIHSVYSNIIKVTIIALILPIGVQYYIDESWGGFIISCIICFIS
VFISIVYVGCNRQERAFIMTKAESFIHNFF