Protein Info for HMPREF1058_RS18425 in Phocaeicola vulgatus CL09T03C04

Annotation: ABC-F family ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 PF00005: ABC_tran" amino acids 21 to 180 (160 residues), 92.8 bits, see alignment E=5.8e-30 amino acids 329 to 463 (135 residues), 75.7 bits, see alignment E=1.2e-24 PF12848: ABC_tran_Xtn" amino acids 219 to 293 (75 residues), 41.4 bits, see alignment E=2.4e-14 PF16326: ABC_tran_CTD" amino acids 552 to 618 (67 residues), 67.4 bits, see alignment E=2.2e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_2939)

Predicted SEED Role

"COG0488: ATPase components of ABC transporters with duplicated ATPase domains" in subsystem Folate Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A708 at UniProt or InterPro

Protein Sequence (621 amino acids)

>HMPREF1058_RS18425 ABC-F family ATP-binding cassette domain-containing protein (Phocaeicola vulgatus CL09T03C04)
MTPYMQVDGLTKSFGDLVLFRKISFGVAEGQRIGLIAKNGTGKTTLLNIIAGKEGYDEGS
IVFRRDLRVGYLEQDPHYPEDLTVLEACFYHGNSTVELIKEYESCMETEGNPGLEELLAR
MEHEKAWDYERKAKQILSQLKIRDFSQQIKHLSGGQLKRVALANVLITEPDFLILDEPTN
HLDLDMTEWLEGYLGRGNISLLMVTHDRYFLDRVCSEIIEIDNQQVYSYKGNYSYYLEKR
QERIEATNAEIARANNLYRTELEWMRRMPQARGHKARYREEAFYELEKVAKQRFNDGNVK
LDMKASYIGSKIFEADHLYKRFGDLKILEDFSYIFARYEKMGIVGNNGTGKSTFIKILMG
EQKPDSGTLDIGETVRFGYYSQDGLKFDEQMKVIDVVQDIAEVIELGNGKKLTASQFLQH
FLFTPETQHSYVYKLSGGERRRLYLCTVLMRNPNFLVLDEPTNDLDIITLQVLEEYLQNF
KGCVIVVSHDRYFMDKVVDHLLVFKGQGDIRDFPGNYSDYRDWREAKEQREKEAEKPKEE
KTARVRLNDKRKMSFKEKKEFEQLEQEIAGLEQEKADIEAALCSGTLGVEELTEKSKRLP
ELNDLIDEKTMRWLELSEIEG