Protein Info for HMPREF1058_RS18285 in Phocaeicola vulgatus CL09T03C04

Annotation: RNA-binding transcriptional accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 709 PF09371: Tex_N" amino acids 8 to 190 (183 residues), 234.3 bits, see alignment E=2.6e-73 PF16921: Tex_YqgF" amino acids 313 to 435 (123 residues), 171.2 bits, see alignment E=4e-54 PF14635: HHH_7" amino acids 448 to 542 (95 residues), 41.9 bits, see alignment E=3.4e-14 PF12836: HHH_3" amino acids 476 to 540 (65 residues), 102.9 bits, see alignment E=2.6e-33 PF17674: HHH_9" amino acids 546 to 615 (70 residues), 95.1 bits, see alignment E=1.1e-30 PF00575: S1" amino acids 634 to 705 (72 residues), 63 bits, see alignment E=8.4e-21

Best Hits

Swiss-Prot: 47% identical to YDCI_BACSU: Uncharacterized protein YdcI (ydcI) from Bacillus subtilis (strain 168)

KEGG orthology group: K06959, uncharacterized protein (inferred from 100% identity to bvu:BVU_2904)

Predicted SEED Role

"S1 RNA binding domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A736 at UniProt or InterPro

Protein Sequence (709 amino acids)

>HMPREF1058_RS18285 RNA-binding transcriptional accessory protein (Phocaeicola vulgatus CL09T03C04)
MELFNKMIAAALKVSVHQVDNTLSLLGGGATIPFISRYRKEATGGLDEVQIGEIKDRNDK
LCELAKRKETILSTIEEQGKLTEELRKRIEQSWDATEVEDIYLPYKPKRKTRAEAARQKG
LEPLATLLLLQRENHLDSRLPAFVKGDVKDEEDALKGARDIIAEQVSEDERARNQLRNQF
SRQAVITSKVVKGKEEEAAKYRDYFDFSEPLKRCSSHRLLAIRRGESEGLLKVSISPDDE
ECAGRLEQMYVRGNNECSRQVGEAVRDAYKRLLKPSIETEFSALSKEKADEEAIRVFAGN
LRQLLLAPPLGQKRVMGVDPGYRTGCKIVCLDAQGSLLHNETIYPHPPKNEYSQAARSIV
KLVEQYQIEAIAIGNGTASRETEQFITSQRYDRELQVFVVSEDGASIYSASKTARDEFPE
YDVTVRGAVSIGRRLMDPLAELVKIDAKSIGVGQYQHDVDQTLLKKSLDQTVESCVNLVG
VNLNTASRHLLTYISGLGPALAQNIVDYRTENGPFSSRKELLKVPRMGAKAFEQCAGFLR
IPQAKNPLDNSAVHPESYPIVEQIAKDLNCTVDELIKSKELRSRIDIKKYVTPTVGLPTL
TDIMQELDKPGRDPRQQIQVFEFDKNVKTIEDLTEGMELPGIVNNITNFGCFVDIGIKEK
GLVHVSQLADKFVSDPTTVVSIHQHVRVKVMSIDLERKRIQLTMKGLNQ