Protein Info for HMPREF1058_RS18210 in Phocaeicola vulgatus CL09T03C04

Annotation: tRNA lysidine(34) synthetase TilS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details PF01171: ATP_bind_3" amino acids 21 to 197 (177 residues), 170.9 bits, see alignment E=2.5e-54 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 21 to 201 (181 residues), 178 bits, see alignment E=1.9e-56 PF11734: TilS_C" amino acids 356 to 425 (70 residues), 25.8 bits, see alignment E=5.6e-10 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 356 to 386 (31 residues), 28.2 bits, see alignment (E = 9.6e-11)

Best Hits

Swiss-Prot: 58% identical to TILS_BACFR: tRNA(Ile)-lysidine synthase (tilS) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 100% identity to bvu:BVU_2888)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A751 at UniProt or InterPro

Protein Sequence (434 amino acids)

>HMPREF1058_RS18210 tRNA lysidine(34) synthetase TilS (Phocaeicola vulgatus CL09T03C04)
MFHWNIQKYIEEKQLFTLHDKVLVALSGGADSVALLRVLLVLGYHCEAAHCNFHLRGEES
DRDERFVNELCKGLGVTLHVTHFDTVTYASRHHVSVEMAAREMRYDWFEQLRKERGMAVI
AVAHHRDDSVETFLLNLIRGAGINGLKGISPHNGCIVRPLLEVSRQDILDYLRCLRQGYV
TDSTNLQDEYMRNKIRLNILPMLRELNPSVSESIAETSRRLTDVSLIYNKEIEAGKERVM
EKSGHILISRLMEESAPAALLFEILHPLGFNSVQVGDVFRSLSAQSGKRFVSAGWEVLRD
RTELIIRRRKPADEEVEENVPPFRLAMETQEIMPDFVIPRNKNTACLDADKVVLPLTVRK
WRQGDKFVPFGMKGKKKVSDYLTDRKFSLFQKENQYVVCSADRIVWLVGERSDDRFRVTE
DTKRVLIIRQLEDK