Protein Info for HMPREF1058_RS18115 in Phocaeicola vulgatus CL09T03C04

Annotation: pyruvate formate lyase-activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02493: pyruvate formate-lyase 1-activating enzyme
  • amino acids 3 to 234 (232 residues), 311.2 bits, E=3.9e-97
• PF13353: Fer4_12
  • amino acids 14 to 144 (131 residues), 70.3 bits, E=2.3e-23
• PF04055: Radical_SAM
  • amino acids 22 to 171 (150 residues), 90.6 bits, E=1.3e-29

Best Hits

Swiss-Prot: 43% identical to PFLA_HAEIN: Pyruvate formate-lyase 1-activating enzyme (pflA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 99% identity to bvu:BVU_2879)

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• pyruvate fermentation to ethanol I (2/3 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

See I9A5R9 at UniProt or InterPro

Protein Sequence (242 amino acids)

>HMPREF1058_RS18115 pyruvate formate lyase-activating protein (Phocaeicola vulgatus CL09T03C04)
MIRVHSYESMGTFDGPGLRLVVFLQGCNFRCFYCANPDTIDTKGESTETAIDEIVHMAVS
QKAFFGKKGGVTFSGGEPTLQAKALIPLFQRLKEQNIHICIDTNGSIWNEEVEELLKWTD
LVLLDIKEFNNVRHRQLTERSNEQTIRTAEWLEKNGKPFWLRYVLVPGYSSFEEDIRALG
EHFKNYHMIQRVEILPYHTLGVHKYEAMGKEYKLNGIKENTLEQLETAKTLFGEYFNTVY
LN