Protein Info for HMPREF1058_RS18030 in Phocaeicola vulgatus CL09T03C04

Annotation: glucose-6-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 7 to 488 (482 residues), 600.3 bits, E=1.4e-184
• PF00479: G6PD_N
  • amino acids 10 to 192 (183 residues), 201 bits, E=2.7e-63
• PF02781: G6PD_C
  • amino acids 194 to 486 (293 residues), 378.1 bits, E=2.7e-117

Best Hits

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 100% identity to bvu:BVU_2796)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• pentose phosphate pathway (8/8 steps found)
• L-lysine biosynthesis VI (7/7 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• heterolactic fermentation (14/18 steps found)
• aspartate superpathway (19/25 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• L-lysine biosynthesis I (6/9 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• cytosolic NADPH production (yeast) (3/5 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (12/18 steps found)
• formaldehyde oxidation I (3/6 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Sequence Analysis Tools

See I9A6V1 at UniProt or InterPro

Protein Sequence (502 amino acids)

>HMPREF1058_RS18030 glucose-6-phosphate dehydrogenase (Phocaeicola vulgatus CL09T03C04)
MSLPHSLFLVIFGASGDLTRRKLMPALIKIHNGKRFPEHFAIIGCARTAYTDETYRAYLK
EELIKFGFLTKEEMETLDDFLSTVHYQSMDPADETTYFLLNDRLKELSPQYENNGNYLFY
LATPPLLYELIPKCLHDAGLLKKPGLKRIIVEKPFGYDLPSAQKLNKIYAAYFKEEDIYR
IDHFLGKETVQNIMVTRFGSTIYEPIWNRNYIDYVEITAVENMGIGTRGGYYDGAGALRD
MVQNHLMQLLAITAMEPPAKFDKNGFRNEVIKVYQSLRPLTDKYIRDNVIRGQYIAGDDR
IGYREEKNVRPDSRTDTYVAMCLYVDNWRWQGVPFYIRTGKQMPTKVTEIVVHFKPAPMQ
MFQMKEGFYKGEELIIRIQPDEGILQRIAMKEPGAGFYMGTMEMDFSYDQHDQETGDAYV
RLLEDSLVGDPTLFTRSDAVDESWTYFDKILDYWKKHPETPLYGYPAGTWGPKEADVLIN
RSHSEWTNPCKNLTHSNLYCKL