Protein Info for HMPREF1058_RS18005 in Phocaeicola vulgatus CL09T03C04

Annotation: anaerobic C4-dicarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 6 to 39 (34 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 131 to 156 (26 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 328 to 346 (19 residues), see Phobius details amino acids 354 to 378 (25 residues), see Phobius details amino acids 410 to 429 (20 residues), see Phobius details PF03605: DcuA_DcuB" amino acids 4 to 365 (362 residues), 509.6 bits, see alignment E=2.4e-157 TIGR00770: transporter, anaerobic C4-dicarboxylate uptake (Dcu) family" amino acids 4 to 431 (428 residues), 534.1 bits, see alignment E=1.4e-164

Best Hits

KEGG orthology group: K07792, anaerobic C4-dicarboxylate transporter DcuB (inferred from 100% identity to bvu:BVU_2791)

Predicted SEED Role

"Anaerobic C4-dicarboxylate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A6V7 at UniProt or InterPro

Protein Sequence (432 amino acids)

>HMPREF1058_RS18005 anaerobic C4-dicarboxylate transporter (Phocaeicola vulgatus CL09T03C04)
MLLQLLFVLVAIIVGARLGGIGLGVMGGVGLAILTFVFGLQPTAPPIDVMLMIVAVISAA
SCMQAAGGLDYMVKLAERLLRRNPSQVTILSPLVTYLFTFVAGTGHVAYSVLPVIAEVAT
ETKIRPERPLGIAVIASQQAITASPISAATVALLGLLTGFDITLFDILKITIPATLIGVL
VGAFLSKKVGKELLEDPEYLRRLEAGMIDTKHVELNDVKNMFHARISVIIFIAATLLIVL
FGSIPAMRPVFNGTALDMPAIIEILMLCAAAVILLISRTDGIKATQGSVFPAGMQAVIAI
FGIAWMGDTFINGNITELTGSIEGIVRQMPWLFGLALFVMSILLYSQAATVRAIVPLGIA
LGISPMMLIALFPAVNGYFFIPNYPTVVAAINFDRTGTTGIGKWILNHSFMMPGMVATIV
SIVVGLLLVQVF