Protein Info for HMPREF1058_RS17860 in Phocaeicola vulgatus CL09T03C04

Annotation: oligopeptide transporter, OPT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 transmembrane" amino acids 38 to 61 (24 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 231 to 248 (18 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 358 to 376 (19 residues), see Phobius details amino acids 385 to 409 (25 residues), see Phobius details amino acids 417 to 436 (20 residues), see Phobius details amino acids 442 to 463 (22 residues), see Phobius details amino acids 484 to 501 (18 residues), see Phobius details amino acids 507 to 524 (18 residues), see Phobius details amino acids 534 to 551 (18 residues), see Phobius details amino acids 557 to 581 (25 residues), see Phobius details amino acids 601 to 621 (21 residues), see Phobius details amino acids 639 to 657 (19 residues), see Phobius details PF03169: OPT" amino acids 37 to 620 (584 residues), 365.4 bits, see alignment E=3.4e-113 TIGR00733: oligopeptide transporter, OPT family" amino acids 40 to 619 (580 residues), 237.7 bits, see alignment E=2.6e-74 TIGR00728: oligopeptide transporter, OPT superfamily" amino acids 42 to 616 (575 residues), 133.1 bits, see alignment E=1.3e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_2756)

Predicted SEED Role

"Oligopeptide transporter, OPT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9UKF0 at UniProt or InterPro

Protein Sequence (663 amino acids)

>HMPREF1058_RS17860 oligopeptide transporter, OPT family (Phocaeicola vulgatus CL09T03C04)
MKQEEEKSVGLPDNAFRPLKPGEQYHPIMSPNKKYPEVNLWSVLWGIAMAVLFSAAAAYL
GLKVGQVFEAAIPIAIIAVGVSGAAKRKNALGENVIIQSIGACSGVIVAGAIFTLPALYI
LQDKYPEMTVNFFQMFVSSLLGGILGILFLIPFRKYFVSDKHGEYPFPEATASTQVLVSG
EKGGSQAKPLLFAGLIGGLYDFIVATFGWWNENFTTRVCGWGEMVAEKAKLVMKINTGAA
VLGLGYIVGLKYAAIICAGSLVVWLVIVPGMALLFGDQVLNAWNPALTQTISEMSPEVIF
KEYAKSIGIGGIAMAGVIGIVRSWGIIKSAVGLAAKEMGGKKVEANVIRTQKDLSMKIIA
FGSIFTILLILLFFFFDVMHGNVLHSIVAILLVAGIAFLFTTVAANAIAIVGTNPVSGMT
LMTLILASVVMVAVGLKGATGMVAALVMGGVVCTALSMAGGFITDLKIGYWLGSTPAKQE
TWKFLGTLVSAATVGGVIMILNKTYGFSTGALAAPQANAMAAVIDPLMNGVGAPWLLYGI
GAVLALVLTYFKVPALAFALGMFIPLELNLPLLVGGAVNWYVTTRSKDEAVNAERGEKGT
LLASGFIAGGALMGVVSAAMRFGGINLINEEWLSNPLSEVLSMAAYILLIIWLVKASMHI
KKK