Protein Info for HMPREF1058_RS17015 in Phocaeicola vulgatus CL09T03C04

Annotation: SpoIID/LytB domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 PF08486: SpoIID" amino acids 96 to 214 (119 residues), 86.5 bits, see alignment E=7.9e-29 TIGR02669: SpoIID/LytB domain" amino acids 100 to 435 (336 residues), 163.4 bits, see alignment E=5.2e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_2596)

Predicted SEED Role

"Amidase enhancer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9UJT9 at UniProt or InterPro

Protein Sequence (438 amino acids)

>HMPREF1058_RS17015 SpoIID/LytB domain-containing protein (Phocaeicola vulgatus CL09T03C04)
MKEPEISVGIVNAQEIHFSLNGNFFAKGETVCGEQQVAFSEGGILWNGNLYRELTFTPQD
EHASFSLYDVTIGINFHWERQETQSFMGTLKLVVDEGKITAINILPAEDYLISVISSEMN
ATSSLEFLKAHAVVSRSWLFAQIEKRKALSDKNEGFFSFIKTDTEYIRWYDREDHTIFDV
CADDHCQRYQGITKASSAAVTEAVRATRGQLLMYERGICDARFSKCCGGASEEFGYCWED
KNYPYLSTIRDSEEEENRPLPDLTKEEEAERWIRTSPVSFCDTHDKKVISQILNNYDQET
TDFYRWKVRYSQAELSELIRQNTKSDYGDIIDLIPIQRGKSGRICKLKIVGSLKTLTIGK
ELEIRRTLSSSHLFSSAFVIDKGELKNGVPEWFLLTGAGWGHGVGLCQIGAAVMGERGYT
YDEILLHYYKGADIRRFY