Protein Info for HMPREF1058_RS16985 in Phocaeicola vulgatus CL09T03C04

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 10 to 30 (21 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details PF06580: His_kinase" amino acids 164 to 241 (78 residues), 87.6 bits, see alignment E=2.8e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_2589)

Predicted SEED Role

"putative two-component system sensor protein histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9J7U4 at UniProt or InterPro

Protein Sequence (347 amino acids)

>HMPREF1058_RS16985 sensor histidine kinase (Phocaeicola vulgatus CL09T03C04)
MAMQNKYNQFFNFFLFSGLACFSYLSLVLYTDLTPQHQKILISSLGFISVVFIFNLVGFS
LIVINRWLKKSSLFFIKKRNKLIINCILIAAILFFMNYATLTICKVLLELPFPFVLSSPG
LRLIMIIWLVEIVIVSLSITSAFYRQLVILHEKTTKLEESSIKAQYTALQNQLNPHFLFN
SLNTLISEIEYNPENAVVFTQKLSDVYRYILKSQEQGLVTLRDELEFLDSYIYLHQVRLG
KCIQLENKMTPTLLNKKIPSLTLQLLIENVIKHNIINMENPMVIHLDYSDKDQTLSVRNK
IKLKKDVAKSGMGLKNLSARYLLICNLHITIIDDSEYFTVKIPLLNE