Protein Info for HMPREF1058_RS16410 in Phocaeicola vulgatus CL09T03C04

Annotation: L-serine ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03315: SDH_beta
  • amino acids 3 to 72 (70 residues), 72.3 bits, E=5.8e-24
  • amino acids 70 to 115 (46 residues), 30.8 bits, 3.5e-11
• TIGR00720: L-serine ammonia-lyase
  • amino acids 74 to 396 (323 residues), 355.9 bits, E=1.7e-110
• PF03313: SDH_alpha
  • amino acids 153 to 395 (243 residues), 265.3 bits, E=6.8e-83

Best Hits

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 100% identity to bvu:BVU_2444)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-serine degradation (3/3 steps found)
• glycine degradation (3/3 steps found)
• D-serine degradation (2/3 steps found)
• L-cysteine degradation II (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• glycine betaine degradation III (4/7 steps found)
• L-methionine biosynthesis II (3/6 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (2/8 steps found)
• purine nucleobases degradation II (anaerobic) (13/24 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

See I9UK50 at UniProt or InterPro

Protein Sequence (402 amino acids)

>HMPREF1058_RS16410 L-serine ammonia-lyase (Phocaeicola vulgatus CL09T03C04)
MKSIRELYRIGTGPSSSHTMGPRKAAEIFLGKHPEAKAFQVTLYGSLAATGKGHMTDVAI
LDTLQPHAPTEIIWKAHVFYPFHPNGMTFKSLNEKGKVTDEWTVFSVGGGALAEEGHDKG
STPEIYDMNRMSEILYWCERTGRNYWEYVQQCEDEDIWDYLAEVWKTMREAIERGLDQEG
VLPGPLNLRRKASTYYIKAKGYKDNLRSRGLVFSYALAVSEENASGGKIVTAPTCGSCGV
VPAVLYHLQKSRDFSDMRILRALATAGLIGNIVKHNASISGAEAGCQAEVGVACSMASAA
ASQLFGGSPAQIEYAAEMGLEHHLGMTCDPVCGLVQIPCIERNAYAAARALDANIYSAFT
DGNHRVSFDKVVEVMKQTGHDLPSLYKETSEGGLAKDYEPMD