Protein Info for HMPREF1058_RS16285 in Phocaeicola vulgatus CL09T03C04

Annotation: ClC family H(+)/Cl(-) exchange transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 146 to 161 (16 residues), see Phobius details amino acids 170 to 194 (25 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 378 to 402 (25 residues), see Phobius details amino acids 411 to 429 (19 residues), see Phobius details PF00654: Voltage_CLC" amino acids 84 to 426 (343 residues), 243.1 bits, see alignment E=4.9e-76 PF02080: TrkA_C" amino acids 462 to 524 (63 residues), 29.4 bits, see alignment E=5.8e-11

Best Hits

KEGG orthology group: None (inferred from 99% identity to bvu:BVU_2424)

Predicted SEED Role

"Voltage-gated chloride channel family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9J5Y7 at UniProt or InterPro

Protein Sequence (532 amino acids)

>HMPREF1058_RS16285 ClC family H(+)/Cl(-) exchange transporter (Phocaeicola vulgatus CL09T03C04)
MKLEKWKNKWKEWSNLRKWQIWKLKLIDARLYFVSIFVGLLTGLVAVPYHYLLWYFFDVR
KTFFTAHYPWYWHVLLFFILWGILIFVASLVKRMPLIAGGGIPQTRAANNGRIRYEHPFK
ELVAKFCGGVLALSAGLSLGREGPSVQIGSYIGTLISRWGHILKGERKQLLAAGAGAGLS
AAFAAPLSSSLLVIESIERFDAPKTAITTLLAGVVAGGVASWMFPTTPYHLISAVVPGLS
FIRQAELYIIFAALMAVIAKFYSLIVPFFQERIPAMKLSIPVKMLYLLIIAYAISLTETN
LTGGGEQFLMMQGMNGTHDIRWLTIMMLIHFVFTLFSLSSGLPGGSFIPTLVTGGLLGQI
FGLVLVQRGWIGYENVSYMMLIGMVAFLVAVVRTPLTAIVLITEITGHFEVFYPSIVVGG
LTYYFTELLQIKPYNVLLYDRMFRSHNPESSEEAGARYHLFVEIMDGSYFDGKEVDTLAL
PNHCIIRSIHRNRKNLLPQGQTLVPGDQVEIEIDAQDIEKLYEPLVSMANIY