Protein Info for HMPREF1058_RS16220 in Phocaeicola vulgatus CL09T03C04

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 759 transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 535 to 556 (22 residues), see Phobius details PF04851: ResIII" amino acids 2 to 136 (135 residues), 72.9 bits, see alignment E=6e-24 PF00270: DEAD" amino acids 12 to 75 (64 residues), 30 bits, see alignment E=8.3e-11 PF00271: Helicase_C" amino acids 216 to 316 (101 residues), 60.6 bits, see alignment E=3.5e-20

Best Hits

KEGG orthology group: None (inferred from 99% identity to bvu:BVU_2412)

Predicted SEED Role

"putative helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A3E3 at UniProt or InterPro

Protein Sequence (759 amino acids)

>HMPREF1058_RS16220 DEAD/DEAH box helicase (Phocaeicola vulgatus CL09T03C04)
MLRDYQIEMKTRLMEAWKAHRSVMVQMPTGTGKTHLLASVVSEFVSSAGSGVWLIAHRRE
LVAQMEETLAKYGIRREDTPVRVMSVQWLSRHWNEAGDAPGLIVIDEAHHALAASYTEMW
KRYPAVKKLGVTATPCRLNRRGFTELFEVLVTSWSIAEFIEKGVLSVFDYVSIRPGSEEQ
RLIDGLEKRGADGDYQVKEMDAVLNRRPGIERLYRSVRQFASGKKGMVYAISIEHARRIA
EYYSRRGVNAVAVDSKTPAMERKRMVEEFRHGKIEVLVNVDVFSEGFDCPDVEFVQLARP
TLSLAKYLQQVGRGLRRSEGKEACMLIDNVGLYRIFGLPTQRWNWDAMFRGRMAGKGSLP
GRMNCDASVTAFPVVERPAEAGGDLVVVMEHGRLLSSIREQVLPDEKEQSLSCRLRAFVD
KETGLWGLEKGDEMLPDASFKEILSIKGRFAVGRLRNGCVRVLDDTGALVAEPGHCREVR
FLKDDLLQVRHAGNSVSYVDLRNGRCYSVRPRVLRYGSIELLQVNRTYYSRTRQVYANTC
GLPFSSIVWMGFYVKMYDGRVPSRCRRMEDGGFCCEPQVCLLEGDEERAYYLSGRLPDQS
IVVMDEEGRYYHVEKGHGKRYVACNRPSDRSEDFDEAVALLRRQADERVEKRLREEKCEY
ERKRQRIISRSVEAVPFQIGVKWGLRTAERILIPPVYRRILHPVGGYCAYQDSSCQWGVL
AVDGRIIIRARYMEVEIDRDGTARLTLVPGKMETVKLTD