Protein Info for HMPREF1058_RS15870 in Phocaeicola vulgatus CL09T03C04

Annotation: ATP phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 TIGR00070: ATP phosphoribosyltransferase" amino acids 2 to 182 (181 residues), 190.5 bits, see alignment E=2.5e-60 PF01634: HisG" amino acids 49 to 203 (155 residues), 167.7 bits, see alignment E=2e-53 TIGR03455: ATP phosphoribosyltransferase, C-terminal domain" amino acids 185 to 282 (98 residues), 116.4 bits, see alignment E=5.7e-38 PF08029: HisG_C" amino acids 208 to 280 (73 residues), 104 bits, see alignment E=3.6e-34

Best Hits

Swiss-Prot: 100% identical to HIS1_BACV8: ATP phosphoribosyltransferase (hisG) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 100% identity to bvu:BVU_2361)

MetaCyc: 47% identical to ATP phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
ATP phosphoribosyltransferase. [EC: 2.4.2.17]

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9J648 at UniProt or InterPro

Protein Sequence (283 amino acids)

>HMPREF1058_RS15870 ATP phosphoribosyltransferase (Phocaeicola vulgatus CL09T03C04)
MLRIAVQSKGRLFEETMALLQEADIKISTSKRILLVQSSNFPIEVLFLRDDDIPQSVAGG
VADLGIVGENEFVERKEDAEVIKRLGFSKCRLSLAIPKDVDYPGLSWFEGRKIATSYPGI
LKDFMDRNGIHSDIHVITGSVEIAPGISLADAIFDIVSSGSTLVSNSLKEVEVVMKSEAL
LIGNKNMSEEKKEILNELLFRIEAVKAAEDKKYVLMNAPTERLKEIIEVLPGMKSPTVMP
LAQEGWSSVHTVLDEKRFWEIIGKLKALGAEGILVLPIEKMIL