Protein Info for HMPREF1058_RS15850 in Phocaeicola vulgatus CL09T03C04

Annotation: transglycosylase SLT domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00497: SBP_bac_3" amino acids 49 to 265 (217 residues), 44.5 bits, see alignment E=1.3e-15 PF01464: SLT" amino acids 289 to 405 (117 residues), 78.2 bits, see alignment E=3.8e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_2357)

Predicted SEED Role

"Transglycosylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9UI50 at UniProt or InterPro

Protein Sequence (459 amino acids)

>HMPREF1058_RS15850 transglycosylase SLT domain-containing protein (Phocaeicola vulgatus CL09T03C04)
MKNVWLLVLACICMTACRNRQQSAEVTNYDLPQIKDSGELVVLTLNSSTSYFDYRGEPMG
FQYELADQFARSLDVKLKIKVAQNARDLVHKLLQGEGDLIAYNLPVTKEFKDSVEFCGED
IITHQVLVQRNTQKKKKALNNVTELIGKEVYVKPGKYLERLINLDKELGGGILIHEVDND
SITTEDLIMQVSNGEIDYAICDNDLAKLNKTYYPNLNIDLAVSFDQRASWAVRKTSPLLG
EAATKWHQENMTSPAYQASSKRYFEISKRTPHGSILSIKDGKISHFDTLFKKYAKDIDWD
WRILASLAYTESNFDTTAVSWAGAKGLMQLMPRTARAMGVPPGKEQNPEESIKAAVKYIA
ATSRSFNAIKDENERMKFVLAAYNAGIGHVLDAMALAEKYGKNKYVWDNSVDNYILLKSN
EEYFNDPVCKNGYFRGVETYNFVKEVMSRGEVYKKKIKD