Protein Info for HMPREF1058_RS15825 in Phocaeicola vulgatus CL09T03C04

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF13439: Glyco_transf_4" amino acids 19 to 219 (201 residues), 64.3 bits, see alignment E=3.8e-21 PF13579: Glyco_trans_4_4" amino acids 21 to 213 (193 residues), 37.1 bits, see alignment E=9.9e-13 PF00534: Glycos_transf_1" amino acids 228 to 369 (142 residues), 99.9 bits, see alignment E=3e-32 PF13692: Glyco_trans_1_4" amino acids 232 to 361 (130 residues), 80.3 bits, see alignment E=4.4e-26 PF13524: Glyco_trans_1_2" amino acids 313 to 388 (76 residues), 32.9 bits, see alignment E=1.5e-11

Best Hits

Predicted SEED Role

"Putative glycosyltransferase protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A2H7 at UniProt or InterPro

Protein Sequence (392 amino acids)

>HMPREF1058_RS15825 glycosyltransferase (Phocaeicola vulgatus CL09T03C04)
MKILLSNKFYYRRGGDCVCTINLEELLKRKGHEVAIFAMQYPDNIETPWSKYFPGEVKFK
PGLGMLEALLRPFGTNEVKRKFTALLDDFCPDIVHLNNIHSQLSPVIAEIAHQKGIKVIW
TLHDYKLLCPRYDCLRNGDAICEECFSDKRKVLEYKCMKHSRLASYLSYWESMKWNRERL
EVCTDIFICPSRFMAEKMRQGGFDSKKIKTVCNFIDTEKCYGKDYTKRGNYYCFIGRLSP
EKGVRTLIEAANALPYKLVVIGGGPLLEELKTVAGNNVEFVGFKQWNDIKELVGRARFSV
IPSEWYENNPLSVIEAQCLGTPVLGARIGGIPELIEEGVTGMTFESRNKEDLRMKIESMM
QHPLNYEMIAGKGQELYGAEIYYQQIMNLYQG