Protein Info for HMPREF1058_RS15680 in Phocaeicola vulgatus CL09T03C04

Annotation: molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 TIGR02349: chaperone protein DnaJ" amino acids 5 to 369 (365 residues), 424.1 bits, see alignment E=2.6e-131 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 92.8 bits, see alignment E=1.7e-30 PF01556: DnaJ_C" amino acids 131 to 352 (222 residues), 154 bits, see alignment E=4.9e-49 PF00684: DnaJ_CXXCXGXG" amino acids 158 to 222 (65 residues), 64.7 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 81% identical to DNAJ_BACTN: Chaperone protein DnaJ (dnaJ) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 100% identity to bvu:BVU_2329)

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A2K6 at UniProt or InterPro

Protein Sequence (391 amino acids)

>HMPREF1058_RS15680 molecular chaperone DnaJ (Phocaeicola vulgatus CL09T03C04)
MAKRDYYEVLEVDKTATLDVIKKAYRKKAIQYHPDKNPGDKEAEEKFKEAAEAYDVLSNP
DKRARYDQFGHAGMSGAAGGGFEGFGQGMSMDDIFSMFGDIFGGHGGGFGGFGGFGGGGR
SAQRKFRGSDLRVKVKLNLKEISTGVEKKFKLKKYVTCDHCHGSGAEGEGGTETCPTCHG
TGSITRTQQSIFGMVQSQSVCPQCNGEGKIIKNKCKACAGEGIVYGEEVVEVKIPAGVAE
GMQLSVNGKGNAGKHNGVPGDLLVVIEEESHPDLIRDENDLIYNLLLSVPTAALGGTVEI
PTIDSKVKVKIEPGTQPGKVLRLRGKGLPNVNSYGYSNGTGDLLVNVSVYIPETLNKDEK
QALEKMQESDNFKPNTSIKEKIFKKFKNFFD