Protein Info for HMPREF1058_RS15050 in Phocaeicola vulgatus CL09T03C04

Annotation: DUF5009 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 231 to 248 (18 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details PF16401: DUF5009" amino acids 10 to 172 (163 residues), 27.6 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to bvu:BVU_2210)

Predicted SEED Role

"N-acetylglucosamine related transporter, NagX" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9UHP2 at UniProt or InterPro

Protein Sequence (363 amino acids)

>HMPREF1058_RS15050 DUF5009 domain-containing protein (Phocaeicola vulgatus CL09T03C04)
MTANTPKRLLALDILRGITIAGMILVNNPGSWGYVYTPLEHAAFNGLTPTDLVFPFFMFI
MGISTYISLRKYNFTYSHAILRKIVKRTVVIFCIGLFLNLLAKSVFTHHLNFEELRYLGV
MQRLAIGYGVTSLVAITVKHKYFPAIILVTLAVYFLLLAMGDGFNLSVTNIVARFDVWAL
GTSHMYHDGGMAFDPEGLLSTLPAVCHVMVGFYCGKLLFSAKDNDEKIQRLFLVGTILTF
AGFLLSYGCPINKKVWSPTFVITTCGLASSFLALLIWIIDIKGYQGWCVFFRSFGVNPLF
IYVFAEIMGILLGATGASVFIYEKVLVPVLGNYPGSLAYALLYVLFCWSIVHILYKKGIY
VKI