Protein Info for HMPREF1058_RS14765 in Phocaeicola vulgatus CL09T03C04

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 80 to 197 (118 residues), 26.9 bits, see alignment E=7.7e-10 PF12697: Abhydrolase_6" amino acids 82 to 282 (201 residues), 29.2 bits, see alignment E=3e-10 PF12146: Hydrolase_4" amino acids 83 to 188 (106 residues), 54.4 bits, see alignment E=2.4e-18

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 100% identity to bvu:BVU_2058)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9UHV0 at UniProt or InterPro

Protein Sequence (323 amino acids)

>HMPREF1058_RS14765 alpha/beta hydrolase (Phocaeicola vulgatus CL09T03C04)
MKHLNFILVGLFFLCGLCCRAQVLPLEENVVLNTKEGQIKGKLLLPGGVKTCPVVLIIAG
SGPTDMDGNSAIGNLRNNSLKFLAEGLAANGIASLRFDKRGIGTSASAGKEEAKLRFEDY
VNDVTGWIDYLAKEKRFTTITVAGHSEGALIGMLACQNRPKVKGYISVAGAGRPAYEIIE
AQVAAQQNPEAVRKEVASINGSLKNGKEVSDVPAYLQSLYRASVQPYLISWFKYNPRTVI
ASVKVPVLIVQGKNDIQVSVEDAELLKKGCPAAELLLIDKMNHVLKDCESKAVQQQMLTY
GNPSLPVNSTLIASVSTFVKKLK