Protein Info for HMPREF1058_RS14725 in Phocaeicola vulgatus CL09T03C04

Annotation: cofactor-independent phosphoglycerate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF01676: Metalloenzyme" amino acids 1 to 390 (390 residues), 136.4 bits, see alignment E=1.3e-43 TIGR02535: proposed homoserine kinase" amino acids 1 to 402 (402 residues), 570.8 bits, see alignment E=1.3e-175 TIGR00306: phosphoglycerate mutase (2,3-diphosphoglycerate-independent), archaeal form" amino acids 4 to 401 (398 residues), 385 bits, see alignment E=4.8e-119 PF10143: PhosphMutase" amino acids 37 to 205 (169 residues), 202.8 bits, see alignment E=3.8e-64

Best Hits

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 100% identity to bvu:BVU_2051)

Predicted SEED Role

"Predicted functional analog of homoserine kinase (EC 2.7.1.-)" in subsystem Threonine and Homoserine Biosynthesis (EC 2.7.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 5.4.2.1

Use Curated BLAST to search for 2.7.1.- or 5.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9J6Q6 at UniProt or InterPro

Protein Sequence (403 amino acids)

>HMPREF1058_RS14725 cofactor-independent phosphoglycerate mutase (Phocaeicola vulgatus CL09T03C04)
MKHIIILGDGMADWPAESLGNKTLLQYSSTPYMDKLAAMGRTGRLVTVAPGFHPGSEVAN
MSVMGYNLPKVYEGRGPLEAASIGVELQPGDMAMRCNIICIEDEKIKNHSAGHITTEEAD
VLVRYLEEKLGSDRIHFYTGVQYRHLLVIKGGNKQLDCTPPHDVPLQPFRPLMVKAEVPE
AQETAGLINNLILASQELLADHPVNQKRIAEGKDPANSIWPWSPGYRPQMEPLSGKYPAI
KKGAVISAVDLINGIGHYAGLRRIAVEGATGLYNTNYENKVAAALEALKTDDFVYLHIEA
SDEAGHEGDFKLKQFTIENLDKRVVGPVYEAVKDWDEPVAIAVLPDHPTPCELRTHTAEP
VPFLIYYPGIEPDCVQTFDEVACVEGSYGILKEDEFMNEFMKK