Protein Info for HMPREF1058_RS14375 in Phocaeicola vulgatus CL09T03C04

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 251 to 268 (18 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 140 (134 residues), 77 bits, see alignment E=8e-26 amino acids 155 to 291 (137 residues), 62.3 bits, see alignment E=2.8e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_1967)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A141 at UniProt or InterPro

Protein Sequence (308 amino acids)

>HMPREF1058_RS14375 DMT family transporter (Phocaeicola vulgatus CL09T03C04)
MAIQKYKGHLALLGAAIMWGLMSPIGKTALENGISGLSLATFRMTGGAICFWIASIFAPK
EQVKPHDLMMLFFAGLLGIVLNQGCFTFGLSLTSPIDASIVTTTAPIATMIVAAIYLKEP
VTGKKVIGIFLGSIGALTLILSSQGSTDGKGGSIPGDLLCLLAQISFSFYLAIFKGLISR
YNIFTLMKWMFTYAAICFIPFSYHEVSTIHFHEISTSTWACVAYVIVGGTFLAYILMMIG
QKTLRPTVISMYNYVQPIVGTSVSILLGMGTFGVAKGIAVALVFTGVYIVTQSKSREQML
AEQAAKKE