Protein Info for HMPREF1058_RS14040 in Phocaeicola vulgatus CL09T03C04

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 PF05970: PIF1" amino acids 21 to 209 (189 residues), 43.7 bits, see alignment E=9e-15 PF13604: AAA_30" amino acids 36 to 210 (175 residues), 82.7 bits, see alignment E=1e-26 PF13245: AAA_19" amino acids 38 to 175 (138 residues), 70.9 bits, see alignment E=4.4e-23 PF09848: SLFN-g3_helicase" amino acids 40 to 207 (168 residues), 27.9 bits, see alignment E=5.2e-10 PF05127: Helicase_RecD" amino acids 46 to 140 (95 residues), 23.9 bits, see alignment E=1.2e-08 PF13538: UvrD_C_2" amino acids 413 to 464 (52 residues), 68.3 bits, see alignment 1.4e-22

Best Hits

KEGG orthology group: K01144, exodeoxyribonuclease V [EC: 3.1.11.5] (inferred from 100% identity to bvu:BVU_1907)

Predicted SEED Role

"RecD-like DNA helicase Atu2026"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9J4Z6 at UniProt or InterPro

Protein Sequence (472 amino acids)

>HMPREF1058_RS14040 AAA family ATPase (Phocaeicola vulgatus CL09T03C04)
MINSYLVQQIKGNFLYKPTLEQEKAVKFLADFLFSRQSDSVFLLKGYAGTGKTSLIGALV
KTLDQLQQKCVLLAPTGRAAKVFSHYAQHPAYTIHKKIYRQRNFSNDLDNFSLDDNLHQH
TLFIVDEASMIANDGLAGAVFGTGRLLDDLIQYVYAGTGCRLMLIGDTAQLPPVGEEESP
ALSADKLRGYGMEVYEAQLTEVVRQMHDSGILWNATELRRYISEENFLTLPSVRVEGFPD
IRMVSGSELIEVINDCYGQAGMDETIVVCRSNKRANIYNKGIRNTILFREDELNSGDLLM
VAKNNYFWTEGCKEIDFIANGDIAVVRRVRRVREAYGFRFADVVLAFPDYDGMELEVKLL
LDTLHTETPALPKELNDKLFYSVLEDYADITVKRERMKKMKADPHYNALQVKYAYAVTCH
KAQGGQWKRVFLDQGYMTEDMLTPDYFRWLYTAFTRATEILYLVNWPKEQTE