Protein Info for HMPREF1058_RS13990 in Phocaeicola vulgatus CL09T03C04

Annotation: DNA polymerase IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00817: IMS" amino acids 9 to 155 (147 residues), 180.7 bits, see alignment E=2.5e-57 PF11798: IMS_HHH" amino acids 171 to 198 (28 residues), 33.2 bits, see alignment (E = 6.1e-12) PF11799: IMS_C" amino acids 241 to 346 (106 residues), 85.1 bits, see alignment E=6.9e-28

Best Hits

Swiss-Prot: 81% identical to DPO4_BACFR: DNA polymerase IV (dinB) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K02346, DNA polymerase IV [EC: 2.7.7.7] (inferred from 99% identity to bvu:BVU_1897)

Predicted SEED Role

"DNA polymerase IV (EC 2.7.7.7)" in subsystem DNA repair, bacterial (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9UH07 at UniProt or InterPro

Protein Sequence (364 amino acids)

>HMPREF1058_RS13990 DNA polymerase IV (Phocaeicola vulgatus CL09T03C04)
MSERKIIHIDMDAFYASVEQRDNPELCGKPLAVGHAEERGVVAAASYEARRYGVHSAMSS
QKAKRLCPELIFVPGRMNVYKAVSRQIHDIFHTYTDIIEPLSLDEAFLDVTENKAGFSLA
IDIAKDIKKRIRKELGLIASAGVSYNKFLAKIASDYRKPDGLCTIHPDQALDFIAHLPIE
SFWGVGPVTAQKMHALGIHNGTQLQACTLEMLTRQFGKAGNLYYDFARGIDLRPVEPIRI
RKSVGCEHTLEKDISLHSSAIIELYHVVTELLERLKRTNFSGNTLTLKIKFHDFNQITRS
ITQDSELTSMDKILPLAKKLLKEIDYESHPIRLIGLSVSNPKEEKEEIKKQWEQLSLEFK
EWDD