Protein Info for HMPREF1058_RS13875 in Phocaeicola vulgatus CL09T03C04

Annotation: UMP kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 75 to 95 (21 residues), see Phobius details TIGR02075: UMP kinase" amino acids 5 to 235 (231 residues), 335.6 bits, see alignment E=7.8e-105 PF00696: AA_kinase" amino acids 5 to 214 (210 residues), 115 bits, see alignment E=2.3e-37

Best Hits

Swiss-Prot: 100% identical to PYRH_BACV8: Uridylate kinase (pyrH) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K09903, uridylate kinase [EC: 2.7.4.22] (inferred from 100% identity to bvu:BVU_1873)

MetaCyc: 55% identical to UMP kinase (Escherichia coli K-12 substr. MG1655)
Cytidylate kinase. [EC: 2.7.4.14, 2.7.4.22]

Predicted SEED Role

"Uridine monophosphate kinase (EC 2.7.4.22)" (EC 2.7.4.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.14

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9UGA1 at UniProt or InterPro

Protein Sequence (236 amino acids)

>HMPREF1058_RS13875 UMP kinase (Phocaeicola vulgatus CL09T03C04)
MARFKRILLKLSGESLMGEKQYGIDEKRLGEYAQQIKEIHDLSVQIGIVIGGGNIFRGLS
GASKGFDRVKGDQMGMLATVINSLGLSSALGAAGVKARVLTAIRMEPIGEFYNKWKAIEA
MENGEVVIMSAGTGNPFFTTDTGSSLRGIEIEADVMLKGTRVDGIYTADPEKDPTATKFD
DITYDEVLKRGLKVMDLTATCMCKENNLPIIVFDMDTVGNLKKVMTGENIGTLVHN