Protein Info for HMPREF1058_RS13400 in Phocaeicola vulgatus CL09T03C04

Annotation: sulfatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00884: Sulfatase" amino acids 29 to 375 (347 residues), 151 bits, see alignment E=1e-47 PF01663: Phosphodiest" amino acids 31 to 326 (296 residues), 26.4 bits, see alignment E=1.1e-09 PF02995: DUF229" amino acids 278 to 331 (54 residues), 27.6 bits, see alignment 2.5e-10 PF16347: SGSH_C" amino acids 328 to 470 (143 residues), 58.9 bits, see alignment E=1.5e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_1771)

Predicted SEED Role

"Iduronate-2-sulfatase (EC 3.1.6.13)" (EC 3.1.6.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.6.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A011 at UniProt or InterPro

Protein Sequence (477 amino acids)

>HMPREF1058_RS13400 sulfatase (Phocaeicola vulgatus CL09T03C04)
MQLKYTLFSSISMLAFSSLSVFSQTEKMNVLFLMADDMRPELGCYGVKEVKTPNIDRFAA
SGLLFQNAYCNIPVSGASRASLLTGVYPHYPDRFVNYSAYASKDCPTAIPISRWFTSHGY
YTISNGKVFHHLSDHANSWSEPPYRKHPDGYDVYWAEYNKWELWMNEASARTINPKTMRG
PFCEWAEVPDTAYDDGKLALKAIADLKRLKEQGKPFFMACGFWKPHLPFNAPKKYWDLYD
REKIPVANNRFRPKDLPNEVKNSTEIYAYARTTTADDISFQKEAKHGYYACLSYVDAQIG
KVLDALDELGLANNTIVVLLGDHGWHLGEHNFLGKHNLMDRSTHVPLIVRVPGLKKGKTK
SMVEFVDLYPTLCELCHLPIPKNQLDGTSFVPILTNLKAKIKDQVYIQWEGGDNAVSNRY
NYAEWKQKEKIHSRMLFDHHIDPEENKNRVNERKYRSEINKLSSFLKAKKETLMKSQ