Protein Info for HMPREF1058_RS13395 in Phocaeicola vulgatus CL09T03C04

Annotation: Fic family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF02661: Fic" amino acids 97 to 195 (99 residues), 77.3 bits, see alignment E=2.8e-25 PF08279: HTH_11" amino acids 275 to 315 (41 residues), 32.9 bits, see alignment 1e-11 PF13412: HTH_24" amino acids 276 to 317 (42 residues), 27 bits, see alignment 5.3e-10

Best Hits

Predicted SEED Role

"Fic family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9J2X6 at UniProt or InterPro

Protein Sequence (333 amino acids)

>HMPREF1058_RS13395 Fic family protein (Phocaeicola vulgatus CL09T03C04)
MYIPPFTISTNAINLIAEISAQIERYAIRLEQSDGLRLRKANRVRTIHSSLAIEGNMLSE
DEVKDIIDGKTVMAPLRQIQEVKNAIKTYELYEKLNPFDVNDLLKAHGTMMMALTDDAGK
FRRGGVGVFSEERLVHMAPPADRVPFLIDDLFEWLKQAKDHLLIRSCVFHYEFEFIHPFS
DGNGRMGRLWQSLILGRLHPLFEYLPVENMVYANQEAYYNAIQHSTATADSGPFIEFMLQ
EILNTLKKHQGSLISQHNVMEVRDKVRDKFGISSEQIIEQIQRNPAVTLDEIAAALSVTR
RSIEKKIKELRDAGYIRREGSNKSGRWIVNDDV