Protein Info for HMPREF1058_RS13315 in Phocaeicola vulgatus CL09T03C04

Annotation: NADH-quinone oxidoreductase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13237: Fer4_10
  • amino acids 65 to 123 (59 residues), 28.5 bits, E=5.5e-10
• PF12800: Fer4_4
  • amino acids 66 to 80 (15 residues), 18.5 bits, see alignment (E = 8.7e-07)
  • amino acids 111 to 123 (13 residues), 14.2 bits, see alignment (E = 2.1e-05)
• PF00037: Fer4
  • amino acids 66 to 84 (19 residues), 26.8 bits, see alignment (E = 1.5e-09)
  • amino acids 106 to 128 (23 residues), 30 bits, 1.5e-10
• PF13187: Fer4_9
  • amino acids 67 to 127 (61 residues), 37.1 bits, E=1.2e-12
• PF12838: Fer4_7
  • amino acids 67 to 126 (60 residues), 48.3 bits, E=5.3e-16

Best Hits

Swiss-Prot: 36% identical to NUOI_ALKEH: NADH-quinone oxidoreductase subunit I (nuoI) from Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 100% identity to bvu:BVU_1755)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)
• Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See I9UE16 at UniProt or InterPro

Protein Sequence (150 amino acids)

>HMPREF1058_RS13315 NADH-quinone oxidoreductase subunit I (Phocaeicola vulgatus CL09T03C04)
MKEEKHSYIKGLLHGIGTLLTGMKVTGREFFTPKVTEQYPENRATLKISPRFRGRLIMPV
DENGNNKCIACGLCQMACPNDTITITSESVTNEETGKKKKILVKYEYDLGACMFCQLCVN
ACPHDAIRFDTEFENAVFDRSKLVLTLNKK