Protein Info for HMPREF1058_RS13140 in Phocaeicola vulgatus CL09T03C04

Annotation: sugar transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details PF02397: Bac_transf" amino acids 21 to 203 (183 residues), 203.6 bits, see alignment E=9.5e-65

Best Hits

KEGG orthology group: None (inferred from 88% identity to pdi:BDI_1355)

MetaCyc: 53% identical to undecaprenyl-phosphate galactose phosphotransferase WbaQ (Porphyromonas gingivalis W50)
Undecaprenyl-phosphate galactose phosphotransferase. [EC: 2.7.8.6]

Predicted SEED Role

"capsular polysaccharide biosynthesis protein" in subsystem Rhamnose containing glycans

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.6

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A088 at UniProt or InterPro

Protein Sequence (209 amino acids)

>HMPREF1058_RS13140 sugar transferase (Phocaeicola vulgatus CL09T03C04)
MEQPTDAFIPDGMNAFQRNVKRIGDCLIAFFALIIFSPLFLYCYIAVKREDGGPAIFKQE
RIGRFGKPFNIYKFRSMRLDAEKFGPALYRGEEDPRLTKIGKFLREHHLDELPQLWNVFV
GDMAFIGPRPERKFYIDQIMEHDPRYRFLYQIRPGVTSYATLYNGYTDTMEKMLRRLRYD
LFYLEHRSWFFDFKILVKTFLNIAFGKKF