Protein Info for HMPREF1058_RS13140 in Phocaeicola vulgatus CL09T03C04
Annotation: sugar transferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 88% identity to pdi:BDI_1355)MetaCyc: 53% identical to undecaprenyl-phosphate galactose phosphotransferase WbaQ (Porphyromonas gingivalis W50)
Undecaprenyl-phosphate galactose phosphotransferase. [EC: 2.7.8.6]
Predicted SEED Role
"capsular polysaccharide biosynthesis protein" in subsystem Rhamnose containing glycans
MetaCyc Pathways
- Salmonella enterica serotype O:3,10 O antigen biosynthesis (2/5 steps found)
- Porphyromonas gingivalis O-LPS antigen biosynthesis (2/6 steps found)
- Salmonella enterica serotype O:2 O antigen biosynthesis (2/6 steps found)
- Salmonella enterica serotype O:4 O antigen biosynthesis (group B1) (2/6 steps found)
- Salmonella enterica serotype O:9 O antigen biosynthesis (2/6 steps found)
- Salmonella enterica serotype O:9,46 O antigen biosynthesis (2/6 steps found)
- Salmonella enterica serotype O:9,46,27 O antigen biosynthesis (2/9 steps found)
- Salmonella enterica serotype O:8 O antigen biosynthesis (1/8 steps found)
- succinoglycan biosynthesis (1/14 steps found)
Isozymes
Compare fitness of predicted isozymes for: 2.7.8.6
Use Curated BLAST to search for 2.7.8.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I9A088 at UniProt or InterPro
Protein Sequence (209 amino acids)
>HMPREF1058_RS13140 sugar transferase (Phocaeicola vulgatus CL09T03C04) MEQPTDAFIPDGMNAFQRNVKRIGDCLIAFFALIIFSPLFLYCYIAVKREDGGPAIFKQE RIGRFGKPFNIYKFRSMRLDAEKFGPALYRGEEDPRLTKIGKFLREHHLDELPQLWNVFV GDMAFIGPRPERKFYIDQIMEHDPRYRFLYQIRPGVTSYATLYNGYTDTMEKMLRRLRYD LFYLEHRSWFFDFKILVKTFLNIAFGKKF