Protein Info for HMPREF1058_RS12890 in Phocaeicola vulgatus CL09T03C04

Annotation: tetraacyldisaccharide 4'-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02606: LpxK
  • amino acids 9 to 349 (341 residues), 281.1 bits, E=6e-88
• TIGR00682: tetraacyldisaccharide 4'-kinase
  • amino acids 15 to 319 (305 residues), 151.5 bits, E=1.5e-48

Best Hits

Swiss-Prot: 100% identical to LPXK_BACV8: Tetraacyldisaccharide 4'-kinase (lpxK) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 100% identity to bvu:BVU_1603)

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (13/17 steps found)
• lipid IV_A biosynthesis (E. coli) (5/6 steps found)
• lipid IV_A biosynthesis (P. putida) (5/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (5/6 steps found)
• lipid IV_A biosynthesis (generic) (5/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (4/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (13/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

See I9J2B6 at UniProt or InterPro

Protein Sequence (366 amino acids)

>HMPREF1058_RS12890 tetraacyldisaccharide 4'-kinase (Phocaeicola vulgatus CL09T03C04)
MEGNLIKINKWLYPVSWIYGTGVWLRNKLFDWGIYKERKFDIPIISVGNITVGGTGKTPH
TEYLIRLLQKDYKVAVLSRGYKRKSKGFVLARPDTSVQMIGDEPFQMKQKFPDIHMAVDR
DRCHGIEQLCNSHIAPGTEVIILDDAFQHRYVKPGINILLVDYHRLICEDTLLPAGRMRE
PENGKSRAHIVIVTKCPKDITPMDLRVLSKQMELYPYQQLYFTTLAYGKLHPLFTAGNAV
SLKEIEKDKHILLVTGIASPAKLIQDLSPYNEHIESLAFSDHHDFTARDMELIKKRFMKL
PEGKRMIITTEKDSVRLAAHPLMDEMLKPYIYMLPIEVAFLQDQQELFNSNITDYVRKNS
RNSNFS