Protein Info for HMPREF1058_RS12750 in Phocaeicola vulgatus CL09T03C04

Annotation: helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF12833: HTH_18" amino acids 73 to 150 (78 residues), 56.2 bits, see alignment E=3.4e-19

Best Hits

KEGG orthology group: None (inferred from 99% identity to bvu:BVU_1477)

Predicted SEED Role

"transcriptional regulator, AraC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9J2E5 at UniProt or InterPro

Protein Sequence (162 amino acids)

>HMPREF1058_RS12750 helix-turn-helix transcriptional regulator (Phocaeicola vulgatus CL09T03C04)
MEYLFLRRKRTTATSERQKTLLFKAAERQWKEEFAGKETDIRKVDCNIYKGILYQLEIRQ
VFLDTSLSLKKLSALLETNQTYLSNVVNKYFGCNLKELVNTYRVEYAKELLCSRRCALTE
LPCSCGFASKSAFYSAFSRIVGVSPLSYQTQERRRHHSQAVN